fulltext.study @t Gmail

Molecular cloning of a gene encoding the sucrose phosphorylase from Leuconostoc mesenteroides B-1149 and the expression in Escherichia coli

Paper ID Volume ID Publish Year Pages File Format Full-Text
18496 42725 2006 9 PDF Available
Title
Molecular cloning of a gene encoding the sucrose phosphorylase from Leuconostoc mesenteroides B-1149 and the expression in Escherichia coli
Abstract

Leuconostoc mesenteroides NRRL B-1149 sucrose phosphorylase (SPase) gene, 1149sp, was isolated and characterized. It is composed of 1479 bp nucleotides and encodes a 1149SPase of 492 amino acid residues with a calculated molecular mass of 56.1 kDa. It has unique C-terminal amino acid sequence (439DVETPSDTTIKITRKDKSGENVAVLVANAADKTFTITANGEEILANTEADKQQL492). 1149sp was expressed in Escherichia coli and the purified 1149SPase specific activity was 1.49 U/mg for sucrose. The optimum temperature and pH for SPase activities were ranged broad between 20 and 50 °C, between pH 6.0 and 7.5, respectively. The optimum temperature and pH were 37 °C at pH 6.7 and it showed Km of 6.3 mM and kcat of 1.59 s−1 for sucrose. It had a broad range of acceptor specificity and transferred the glucosyl moiety of sucrose or glucose-1-phosphate to various acceptors.

Keywords
Leuconostoc mesenteroides; Sucrose phosphorylase; Expression; Acceptor reaction
First Page Preview
Molecular cloning of a gene encoding the sucrose phosphorylase from Leuconostoc mesenteroides B-1149 and the expression in Escherichia coli
Get Full-Text Now
Don't Miss Today's Special Offer
Price was $35.95
You save - $31
Price after discount Only $4.95
100% Money Back Guarantee
Full-text PDF Download
Online Support
Any Questions? feel free to contact us
Publisher
Database: Elsevier - ScienceDirect
Journal: Enzyme and Microbial Technology - Volume 39, Issue 4, 2 August 2006, Pages 612–620
Authors
, , , , , ,
Subjects
Physical Sciences and Engineering Chemical Engineering Bioengineering
Get Full-Text Now
Don't Miss Today's Special Offer
Price was $35.95
You save - $31
Price after discount Only $4.95
100% Money Back Guarantee
Full-text PDF Download
Online Support
Any Questions? feel free to contact us